PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA06G29160.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 497aa    MW: 53058.4 Da    PI: 9.1569
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA06G29160.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.75.3e-41202278278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      CqvegC++dls+a+eyhr+hkvCe+hskap+v+vsgle+rfCqqCsrfh l efD++k+sCrrrL++hn+rrrk+q+
  ONIVA06G29160.2 202 CQVEGCKVDLSSAREYHRKHKVCEAHSKAPKVIVSGLERRFCQQCSRFHGLAEFDQKKKSCRRRLSDHNARRRKPQQ 278
                      **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.0E-33194263IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.496199276IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-38201281IPR004333Transcription factor, SBP-box
PfamPF031101.8E-31202275IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MANRWLLAGR STSTAVEILN SAMASFGMNW NQKSPVFWDW ENPAPFGPNT MENPKSIPHP  60
EPRGVVVAAA NHGSTNSSGG TFTSSSELAN GSSKSSLSAS FDSSSKLGNS LEFRFASVKG  120
HGKNMCKDGE AGRVEDSGTS PAVAVSHGEP VIGLKLGKRT YFENVCGGQN VKSSSAASGV  180
TCPSTVVKKV KVSQQSTQSS YCQVEGCKVD LSSAREYHRK HKVCEAHSKA PKVIVSGLER  240
RFCQQCSRFH GLAEFDQKKK SCRRRLSDHN ARRRKPQQEA ISFGSSRLAT MFYDARQQTD  300
IYFGQSPFGQ VRSNAISSCD NLGGFKFTEA KLPWMKPMKT IGLEDLNFST LQMPGNVVSH  360
TVHHHDFDGL IPFKGNTTKV LNQGVDPACA VVSSNSNGAP DLRRALSLLS SDSWGPADVQ  420
AGSQVHPGGV MPPLAVAAAT VTAPTNPVSV MHALHPSTGG GGFWQDGDDP PPLDHASQAQ  480
AFMHPGNGSS SGYGHLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-282022751184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1257274KKKSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0731790.0AK073179.1 Oryza sativa Japonica Group cDNA clone:J033004F21, full insert sequence.
GenBankAK1021360.0AK102136.1 Oryza sativa Japonica Group cDNA clone:J033085H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643462.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643461.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643459.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643458.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643457.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643456.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643455.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643454.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643453.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643452.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643451.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643450.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643449.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643448.10.0PREDICTED: squamosa promoter-binding-like protein 12
SwissprotA2YGR50.0SPL12_ORYSI; Squamosa promoter-binding-like protein 12
TrEMBLA0A0E0HV120.0A0A0E0HV12_ORYNI; Uncharacterized protein
STRINGBGIOSGA020577-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-47squamosa promoter binding protein-like 2